CLIC1 Antikörper (C-Term)
-
- Target Alle CLIC1 Antikörper anzeigen
- CLIC1 (Chloride Intracellular Channel 1 (CLIC1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CLIC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CLIC1 antibody was raised against the C terminal of CLIC1
- Aufreinigung
- Purified
- Immunogen
- CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST
- Top Product
- Discover our top product CLIC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CLIC1 Blocking Peptide, catalog no. 33R-5478, is also available for use as a blocking control in assays to test for specificity of this CLIC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLIC1 (Chloride Intracellular Channel 1 (CLIC1))
- Andere Bezeichnung
- CLIC1 (CLIC1 Produkte)
- Synonyme
- ncc27 antikoerper, xclic1 antikoerper, MGC75951 antikoerper, MGC132377 antikoerper, CLIC1 antikoerper, G6 antikoerper, NCC27 antikoerper, Clcp antikoerper, wu:fc30e04 antikoerper, zgc:77044 antikoerper, chloride intracellular channel 1 antikoerper, chloride intracellular channel 1 S homeolog antikoerper, clic1 antikoerper, CLIC1 antikoerper, Clic1 antikoerper, clic1.S antikoerper
- Hintergrund
- Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
- Molekulargewicht
- 27 kDa (MW of target protein)
-