KCTD6 Antikörper (N-Term)

Produktnummer ABIN630063

Produktdetails anti-KCTD6 Antikörper

Target: KCTD6 (Potassium Channel Tetramerisation Domain Containing 6 (KCTD6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCTD6 antibody was raised against the N terminal of KCTD6

Aufreinigung: Purified

Immunogen: KCTD6 antibody was raised using the N terminal of KCTD6 corresponding to a region with amino acids LRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVV

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD6 Blocking Peptide, catalog no. 33R-5400, is also available for use as a blocking control in assays to test for specificity of this KCTD6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD6

Target: KCTD6 (Potassium Channel Tetramerisation Domain Containing 6 (KCTD6))

Andere Bezeichnung: KCTD6 (KCTD6 Produkte)

Synonyme: KCTD6 antikoerper, 5430433B02Rik antikoerper, AU044285 antikoerper, kctd6 antikoerper, zgc:91884 antikoerper, KCASH3 antikoerper, potassium channel tetramerization domain containing 6 antikoerper, potassium channel tetramerisation domain containing 6 antikoerper, potassium channel tetramerization domain containing 6b antikoerper, KCTD6 antikoerper, kctd6 antikoerper, Kctd6 antikoerper, kctd6b antikoerper

Hintergrund: KCTD6 is a domain of potassium channel

Molekulargewicht: 26 kDa (MW of target protein)