KCTD11 Antikörper (N-Term)
-
- Target Alle KCTD11 Antikörper anzeigen
- KCTD11 (Potassium Channel Tetramerisation Domain Containing 11 (KCTD11))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCTD11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCTD11 antibody was raised against the N terminal of KCTD11
- Aufreinigung
- Purified
- Immunogen
- KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH
- Top Product
- Discover our top product KCTD11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCTD11 Blocking Peptide, catalog no. 33R-1090, is also available for use as a blocking control in assays to test for specificity of this KCTD11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCTD11 (Potassium Channel Tetramerisation Domain Containing 11 (KCTD11))
- Andere Bezeichnung
- KCTD11 (KCTD11 Produkte)
- Synonyme
- KCTD11 antikoerper, AF465352 antikoerper, Ren antikoerper, C17orf36 antikoerper, KCASH1 antikoerper, REN antikoerper, REN/KCTD11 antikoerper, potassium channel tetramerization domain containing 11 antikoerper, potassium channel tetramerisation domain containing 11 antikoerper, KCTD11 antikoerper, Kctd11 antikoerper
- Hintergrund
- The KCTD11 gene encodes a protein that has been identified as a suppressor of Hedgehog signaling. Its inactivation might lead to a deregulation of the tumor-promoting Hedgehog pathway in medulloblastoma.
- Molekulargewicht
- 26 kDa (MW of target protein)
- Pathways
- Hedgehog Signalweg
-