Bestrophin 4 Antikörper (N-Term)
-
- Target Alle Bestrophin 4 (BEST4) Antikörper anzeigen
- Bestrophin 4 (BEST4)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Bestrophin 4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- VMD2 L2 antibody was raised against the N terminal Of Vmd2 2
- Aufreinigung
- Purified
- Immunogen
- VMD2 L2 antibody was raised using the N terminal Of Vmd2 2 corresponding to a region with amino acids MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITY
- Top Product
- Discover our top product BEST4 Primärantikörper
-
anti-Bestrophin 4 (BEST4) (Internal Region) antibody
BEST4 Reaktivität: Human, Affe IHC (p), IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Bestrophin 4 (BEST4) (Internal Region) antibodyBEST4 Reaktivität: Human, Rind (Kuh), Kaninchen, Schwein, Fledermaus IHC (p), IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Bestrophin 4 (BEST4) (N-Term) antibodyBEST4 Reaktivität: Human, Hund, Rind (Kuh), Kaninchen, Meerschweinchen, Maus, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Bestrophin 4 (BEST4) (N-Term) antibodyBEST4 Reaktivität: Human, Hund, Rind (Kuh), Kaninchen, Meerschweinchen, Maus, Pferd, Ratte, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VMD2L2 Blocking Peptide, catalog no. 33R-6572, is also available for use as a blocking control in assays to test for specificity of this VMD2L2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VMD0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Bestrophin 4 (BEST4)
- Andere Bezeichnung
- VMD2L2 (BEST4 Produkte)
- Synonyme
- CG7259 antikoerper, CT22395 antikoerper, Dmel\\CG7259 antikoerper, dbest4 antikoerper, BEST4 antikoerper, VMD2L2 antikoerper, vmd2l2 antikoerper, Bestrophin 4 antikoerper, bestrophin 4 antikoerper, Best4 antikoerper, BEST4 antikoerper, best4 antikoerper
- Hintergrund
- VMD2L2 is 1 of 3 VMD2-like genes which encode transmembrane spanning proteins that share a homology region with a high content of aromatic residues including an invariant arginine (R), phenylalanine (F), and proline (P) motif.
- Molekulargewicht
- 52 kDa (MW of target protein)
-
