CLIC2 Antikörper (C-Term)

Produktnummer ABIN630069

Produktdetails anti-CLIC2 Antikörper

Target: CLIC2 (Chloride Intracellular Channel 2 (CLIC2))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLIC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CLIC2 antibody was raised against the C terminal of CLIC2

Aufreinigung: Purified

Immunogen: CLIC2 antibody was raised using the C terminal of CLIC2 corresponding to a region with amino acids SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLIC2 Blocking Peptide, catalog no. 33R-8293, is also available for use as a blocking control in assays to test for specificity of this CLIC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLIC2

Target: CLIC2 (Chloride Intracellular Channel 2 (CLIC2))

Andere Bezeichnung: CLIC2 (CLIC2 Produkte)

Synonyme: zgc:92762 antikoerper, CLIC2 antikoerper, CLIC2b antikoerper, MRXS32 antikoerper, XAP121 antikoerper, chloride intracellular channel 2 antikoerper, clic2 antikoerper, CLIC2 antikoerper, Clic2 antikoerper

Hintergrund: Chloride intracellular channel 2 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel 2 encodes a protein that is detected in fetal liver and adult skeletal muscle tissue. CLIon Channel2 maps to the candidate region on chromosome X for incontinentia pigmenti.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity