CLIC2 Antikörper (C-Term)
-
- Target Alle CLIC2 Antikörper anzeigen
- CLIC2 (Chloride Intracellular Channel 2 (CLIC2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CLIC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CLIC2 antibody was raised against the C terminal of CLIC2
- Aufreinigung
- Purified
- Immunogen
- CLIC2 antibody was raised using the C terminal of CLIC2 corresponding to a region with amino acids SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG
- Top Product
- Discover our top product CLIC2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CLIC2 Blocking Peptide, catalog no. 33R-8293, is also available for use as a blocking control in assays to test for specificity of this CLIC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLIC2 (Chloride Intracellular Channel 2 (CLIC2))
- Andere Bezeichnung
- CLIC2 (CLIC2 Produkte)
- Synonyme
- zgc:92762 antikoerper, CLIC2 antikoerper, CLIC2b antikoerper, MRXS32 antikoerper, XAP121 antikoerper, chloride intracellular channel 2 antikoerper, clic2 antikoerper, CLIC2 antikoerper, Clic2 antikoerper
- Hintergrund
- Chloride intracellular channel 2 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel 2 encodes a protein that is detected in fetal liver and adult skeletal muscle tissue. CLIon Channel2 maps to the candidate region on chromosome X for incontinentia pigmenti.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- Negative Regulation of Transporter Activity
-