CLIC5 Antikörper (C-Term)

Produktnummer ABIN630075

Produktdetails anti-CLIC5 Antikörper

Target: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLIC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CLIC5 antibody was raised against the C terminal of CLIC5

Aufreinigung: Purified

Immunogen: CLIC5 antibody was raised using the C terminal of CLIC5 corresponding to a region with amino acids YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLIC5 Blocking Peptide, catalog no. 33R-10228, is also available for use as a blocking control in assays to test for specificity of this CLIC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLIC5

Target: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Andere Bezeichnung: CLIC5 (CLIC5 Produkte)

Synonyme: MST130 antikoerper, MSTP130 antikoerper, 5730531E12Rik antikoerper, B330005L24 antikoerper, Gm322 antikoerper, jbg antikoerper, clic5 antikoerper, im:6907594 antikoerper, zgc:77538 antikoerper, CLIC5 antikoerper, zgc:101827 antikoerper, chloride intracellular channel 5 antikoerper, chloride intracellular channel 5b antikoerper, chloride intracellular channel 5a antikoerper, chloride intracellular channel 5 L homeolog antikoerper, CLIC5 antikoerper, Clic5 antikoerper, clic5b antikoerper, clic5a antikoerper, clic5.L antikoerper

Hintergrund: Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Sensory Perception of Sound