KCTD10 Antikörper (N-Term)

Produktnummer ABIN630076

Produktdetails anti-KCTD10 Antikörper

Target: KCTD10 (Potassium Channel Tetramerisation Domain Containing 10 (KCTD10))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCTD10 antibody was raised against the N terminal of KCTD10

Aufreinigung: Purified

Immunogen: KCTD10 antibody was raised using the N terminal of KCTD10 corresponding to a region with amino acids MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD10 Blocking Peptide, catalog no. 33R-5908, is also available for use as a blocking control in assays to test for specificity of this KCTD10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD10

Target: KCTD10 (Potassium Channel Tetramerisation Domain Containing 10 (KCTD10))

Andere Bezeichnung: KCTD10 (KCTD10 Produkte)

Synonyme: kctd10 antikoerper, KCTD10 antikoerper, wu:fb30g12 antikoerper, zgc:63846 antikoerper, AW536343 antikoerper, C87062 antikoerper, mBACURD3 antikoerper, BTBD28 antikoerper, ULRO61 antikoerper, hBACURD3 antikoerper, potassium channel tetramerization domain containing 10 antikoerper, potassium channel tetramerisation domain containing 10 antikoerper, potassium channel tetramerization domain containing 10 L homeolog antikoerper, KCTD10 antikoerper, kctd10 antikoerper, Kctd10 antikoerper, kctd10.L antikoerper

Hintergrund: KCTD10, a rat potassium channel tetramerisation domain-containing 10 gene is a novel member of the polymerase delta-interacting protein 1 (PDIP1) gene family. KCTD10 shares significant similarity in amino acid sequence to PDIP1 and can interact with the small subunit of DNA polymerase delta and PCNA as PDIP1 does. Like PDIP1, the expression of KCTD10 gene can be induced by TNF-alpha in NIH3T3 cells.

Molekulargewicht: 34 kDa (MW of target protein)