KCTD18 Antikörper (N-Term)

Produktnummer ABIN630077

Produktdetails anti-KCTD18 Antikörper

Target: KCTD18 (Potassium Channel Tetramerisation Domain Containing 18 (KCTD18))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCTD18 antibody was raised against the N terminal of KCTD18

Aufreinigung: Purified

Immunogen: KCTD18 antibody was raised using the N terminal of KCTD18 corresponding to a region with amino acids LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD18 Blocking Peptide, catalog no. 33R-5035, is also available for use as a blocking control in assays to test for specificity of this KCTD18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD18

Target: KCTD18 (Potassium Channel Tetramerisation Domain Containing 18 (KCTD18))

Andere Bezeichnung: KCTD18 (KCTD18 Produkte)

Synonyme: KCTD18 antikoerper, 4932411A20Rik antikoerper, 6530404F10Rik antikoerper, RGD1564820 antikoerper, potassium channel tetramerization domain containing 18 antikoerper, potassium channel tetramerization domain containing 18 L homeolog antikoerper, potassium channel tetramerisation domain containing 18 antikoerper, KCTD18 antikoerper, kctd18.L antikoerper, Kctd18 antikoerper

Hintergrund: The function of Anti-KCTD18 has not yet been determined.

Molekulargewicht: 47 kDa (MW of target protein)