KCNRG Antikörper (N-Term)

Produktnummer ABIN630080

Produktdetails anti-KCNRG Antikörper

Target: KCNRG (Potassium Channel Regulator (KCNRG))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNRG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNRG antibody was raised against the N terminal of KCNRG

Aufreinigung: Purified

Immunogen: KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNRG Blocking Peptide, catalog no. 33R-9475, is also available for use as a blocking control in assays to test for specificity of this KCNRG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNRG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNRG

Target: KCNRG (Potassium Channel Regulator (KCNRG))

Andere Bezeichnung: KCNRG (KCNRG Produkte)

Synonyme: DLTET antikoerper, Clld4 antikoerper, E030012H22Rik antikoerper, Gm745 antikoerper, putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase antikoerper, potassium channel regulator antikoerper, LOC5569660 antikoerper, KCNRG antikoerper, Kcnrg antikoerper

Hintergrund: KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function.

Molekulargewicht: 31 kDa (MW of target protein)