ASIC3 Antikörper (N-Term)
-
- Target Alle ASIC3 (ACCN3) Antikörper anzeigen
- ASIC3 (ACCN3) (Amiloride-Sensitive Cation Channel 3 (ACCN3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ASIC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- ACCN3 antibody was raised against the N terminal of ACCN3
- Aufreinigung
- Purified
- Immunogen
- ACCN3 antibody was raised using the N terminal of ACCN3 corresponding to a region with amino acids VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL
- Top Product
- Discover our top product ACCN3 Primärantikörper
-
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (AA 62-320) antibody
ACCN3 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (AA 53-102) antibodyACCN3 Reaktivität: Human, Ratte, Maus, Kaninchen, Rind (Kuh), Hund, Meerschweinchen, Pferd WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (N-Term) antibodyACCN3 Reaktivität: Human, Ratte, Maus, Kaninchen, Rind (Kuh), Hund, Meerschweinchen, Pferd, Schwein WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (AA 2-16), (Intracellular), (N-Term) antibodyACCN3 Reaktivität: Ratte, Maus WB, IHC, IF Wirt: Meerschweinchen Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (AA 55-83), (N-Term) antibodyACCN3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB40995 unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (AA 1-549) antibodyACCN3 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (AA 2-16), (Intracellular), (N-Term) antibodyACCN3 Reaktivität: Human, Ratte, Maus WB, IHC, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (Internal Region) antibodyACCN3 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACCN3 Blocking Peptide, catalog no. 33R-9439, is also available for use as a blocking control in assays to test for specificity of this ACCN3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASIC3 (ACCN3) (Amiloride-Sensitive Cation Channel 3 (ACCN3))
- Andere Bezeichnung
- ACCN3 (ACCN3 Produkte)
- Synonyme
- ACCN3 antikoerper, Accn3 antikoerper, DRASIC antikoerper, SLNAC1 antikoerper, TNaC1 antikoerper, AW742291 antikoerper, TNAC1 antikoerper, amiloride-sensitive cation channel 3 antikoerper, acid sensing ion channel subunit 3 antikoerper, acid-sensing (proton-gated) ion channel 3 antikoerper, ACCN3 antikoerper, ASIC3 antikoerper, Asic3 antikoerper
- Hintergrund
- ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing.
- Molekulargewicht
- 58 kDa (MW of target protein)
-
