CLCN6 Antikörper (C-Term)
-
- Target Alle CLCN6 Antikörper anzeigen
- CLCN6 (Chloride Channel, Voltage-Sensitive 6 (CLCN6))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CLCN6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CLCN6 antibody was raised against the C terminal of CLCN6
- Aufreinigung
- Purified
- Immunogen
- CLCN6 antibody was raised using the C terminal of CLCN6 corresponding to a region with amino acids PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS
- Top Product
- Discover our top product CLCN6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CLCN6 Blocking Peptide, catalog no. 33R-7295, is also available for use as a blocking control in assays to test for specificity of this CLCN6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCN6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLCN6 (Chloride Channel, Voltage-Sensitive 6 (CLCN6))
- Andere Bezeichnung
- CLCN6 (CLCN6 Produkte)
- Synonyme
- CLC-6 antikoerper, AI850629 antikoerper, CLCN6 antikoerper, wu:fb95f01 antikoerper, DKFZp469B244 antikoerper, DKFZp469L0417 antikoerper, chloride voltage-gated channel 6 antikoerper, chloride channel, voltage-sensitive 6 antikoerper, chloride channel 6 antikoerper, chloride transport protein 6 antikoerper, CLCN6 antikoerper, Clcn6 antikoerper, clcn6 antikoerper, LOC579870 antikoerper
- Hintergrund
- The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 6 and 7 belong to a subbranch of this family. Chloride channel 6 has four different alternatively spliced transcript variants. This gene is in close vicinity to two other kidney-specific chloride channel genes, CLCNKA and CLCNKB.
- Molekulargewicht
- 39 kDa (MW of target protein)
-