CHRNB2 Antikörper
-
- Target Alle CHRNB2 Antikörper anzeigen
- CHRNB2 (Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHRNB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- CHRNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDI
- Top Product
- Discover our top product CHRNB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHRNB2 Blocking Peptide, catalog no. 33R-4429, is also available for use as a blocking control in assays to test for specificity of this CHRNB2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHRNB2 (Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2))
- Andere Bezeichnung
- CHRNB2 (CHRNB2 Produkte)
- Synonyme
- EFNL3 antikoerper, nAChRB2 antikoerper, NACHRB2 antikoerper, Acrb-2 antikoerper, Acrb2 antikoerper, C030030P04Rik antikoerper, [b]2-nAchR antikoerper, cholinergic receptor nicotinic beta 2 subunit antikoerper, cholinergic receptor nicotinic beta 2 subunit S homeolog antikoerper, cholinergic receptor, nicotinic, beta polypeptide 2 (neuronal) antikoerper, CHRNB2 antikoerper, chrnb2.S antikoerper, Chrnb2 antikoerper
- Hintergrund
- Mutations in nAChRs are found in a rare form of nocturnal frontal lobe epilepsy . Previously, some nAChR mutations have been described that are associated with additional neurological features such as psychiatric disorders or cognitive defects. A new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. Phenotypically, the mutation is associated not only with typical ADNFLE, but also with distinct deficits in memory. The cognitive problems are most obvious in tasks requiring the organization and storage of verbal information.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Feeding Behaviour
-