GABRA3 Antikörper

Produktnummer ABIN630101

Produktdetails anti-GABRA3 Antikörper

Target: GABRA3 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 3 (GABRA3))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GABRA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: GABRA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GABRA3 Blocking Peptide, catalog no. 33R-1156, is also available for use as a blocking control in assays to test for specificity of this GABRA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GABRA3

Target: GABRA3 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 3 (GABRA3))

Andere Bezeichnung: GABRA3 (GABRA3 Produkte)

Hintergrund: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Molekulargewicht: 55 kDa (MW of target protein)