GRIK2 Antikörper (N-Term)
-
- Target Alle GRIK2 Antikörper anzeigen
- GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GRIK2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GRIK2 antibody was raised against the N terminal of GRIK2
- Aufreinigung
- Purified
- Immunogen
- GRIK2 antibody was raised using the N terminal of GRIK2 corresponding to a region with amino acids LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLP
- Top Product
- Discover our top product GRIK2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GRIK2 Blocking Peptide, catalog no. 33R-5447, is also available for use as a blocking control in assays to test for specificity of this GRIK2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIK2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))
- Andere Bezeichnung
- GRIK2 (GRIK2 Produkte)
- Synonyme
- GRIK5 antikoerper, eaa4 antikoerper, glr6 antikoerper, gluk6 antikoerper, glur6 antikoerper, grik2 antikoerper, mrt6 antikoerper, GluR6 antikoerper, grik2-A antikoerper, EAA4 antikoerper, GLR6 antikoerper, GLUK6 antikoerper, GLUR6 antikoerper, GluK2 antikoerper, MRT6 antikoerper, AW124492 antikoerper, Glur-6 antikoerper, Glur6 antikoerper, Glurbeta2 antikoerper, GRIK2 antikoerper, glutamate ionotropic receptor kainate type subunit 2 antikoerper, glutamate receptor, ionotropic, kainate 2 L homeolog antikoerper, glutamate receptor, ionotropic, kainate 2 antikoerper, glutamate receptor, ionotropic, kainate 2 (beta 2) antikoerper, GRIK2 antikoerper, grik2.L antikoerper, grik2 antikoerper, Grik2 antikoerper
- Hintergrund
- GRIK2 encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus.
- Molekulargewicht
- 98 kDa (MW of target protein)
- Pathways
- Synaptic Membrane, Regulation of long-term Neuronal Synaptic Plasticity
-