KCNK10 Antikörper (N-Term)

Produktnummer ABIN630107

Produktdetails anti-KCNK10 Antikörper

Target: KCNK10 (Potassium Channel, Subfamily K, Member 10 (KCNK10))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNK10 antibody was raised against the N terminal of KCNK10

Aufreinigung: Purified

Immunogen: KCNK10 antibody was raised using the N terminal of KCNK10 corresponding to a region with amino acids VVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK10 Blocking Peptide, catalog no. 33R-9866, is also available for use as a blocking control in assays to test for specificity of this KCNK10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK10

Target: KCNK10 (Potassium Channel, Subfamily K, Member 10 (KCNK10))

Andere Bezeichnung: KCNK10 (KCNK10 Produkte)

Synonyme: KCNK10 antikoerper, K2p10.1 antikoerper, TREK-2 antikoerper, TREK2 antikoerper, 1700024D23Rik antikoerper, 3010005K24Rik antikoerper, Trek2 antikoerper, k2p10.1 antikoerper, trek-2 antikoerper, trek2 antikoerper, potassium two pore domain channel subfamily K member 10 antikoerper, potassium channel, subfamily K, member 10 antikoerper, potassium channel, two pore domain subfamily K, member 10 L homeolog antikoerper, KCNK10 antikoerper, Kcnk10 antikoerper, kcnk10.L antikoerper

Hintergrund: KCNK10 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is highly expressed in the kidney and pancreas. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. The protein is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Three transcript variants have been identified for this gene.

Molekulargewicht: 59 kDa (MW of target protein)