FZD9 Antikörper

Produktnummer ABIN630125

Produktdetails anti-FZD9 Antikörper

Target: FZD9 (Frizzled Family Receptor 9 (FZD9))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FZD9 Blocking Peptide, catalog no. 33R-8100, is also available for use as a blocking control in assays to test for specificity of this FZD9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FZD9

Target: FZD9 (Frizzled Family Receptor 9 (FZD9))

Andere Bezeichnung: FZD9 (FZD9 Produkte)

Synonyme: CD349 antikoerper, FZD3 antikoerper, mfz9 antikoerper, Fz-9 antikoerper, cFz-9 antikoerper, fz11 antikoerper, fzd9 antikoerper, fzx antikoerper, hm:zehl0603 antikoerper, zehl0603 antikoerper, zg11 antikoerper, frizzled class receptor 9 antikoerper, frizzled class receptor 9a antikoerper, frizzled class receptor 9b antikoerper, FZD9 antikoerper, Fzd9 antikoerper, fzd9a antikoerper, fzd9b antikoerper

Hintergrund: FZD9 contains 1 FZ (frizzled) domain and belongs to the G-protein coupled receptor Fz/Smo family. It is receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: WNT Signalweg