PCMT1 Antikörper

Produktnummer ABIN630131

Produktdetails anti-PCMT1 Antikörper

Target: PCMT1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCMT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: PCMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCMT1 Blocking Peptide, catalog no. 33R-1442, is also available for use as a blocking control in assays to test for specificity of this PCMT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCMT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCMT1

Target: PCMT1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1))

Andere Bezeichnung: PCMT1 (PCMT1 Produkte)

Synonyme: PIMT antikoerper, C79501 antikoerper, PCM antikoerper, PCMT antikoerper, etID309741.20 antikoerper, fj13d06 antikoerper, pimt antikoerper, wu:fj13d06 antikoerper, protein-L-isoaspartate (D-aspartate) O-methyltransferase antikoerper, protein-L-isoaspartate (D-aspartate) O-methyltransferase 1 antikoerper, protein-L-isoaspartate (D-aspartate) O-methyltransferase L homeolog antikoerper, protein-L-isoaspartate(D-aspartate)O-methyltransferase antikoerper, PCMT1 antikoerper, Pcmt1 antikoerper, pcmt1.L antikoerper, pcmt1 antikoerper, pcmt antikoerper

Hintergrund: Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization