NAGS Antikörper (C-Term)
-
- Target Alle NAGS Antikörper anzeigen
- NAGS (N-Acetylglutamate Synthase (NAGS))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NAGS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NAGS antibody was raised against the C terminal of NAGS
- Aufreinigung
- Purified
- Immunogen
- NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD
- Top Product
- Discover our top product NAGS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NAGS Blocking Peptide, catalog no. 33R-10162, is also available for use as a blocking control in assays to test for specificity of this NAGS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAGS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NAGS (N-Acetylglutamate Synthase (NAGS))
- Andere Bezeichnung
- NAGS (NAGS Produkte)
- Hintergrund
- NAGS is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia.
- Molekulargewicht
- 58 kDa (MW of target protein)
-