LNX1 Antikörper (C-Term)
-
- Target Alle LNX1 Antikörper anzeigen
- LNX1 (Ligand of Numb-Protein X 1 (LNX1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LNX1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LNX1 antibody was raised against the C terminal of LNX1
- Aufreinigung
- Purified
- Immunogen
- LNX1 antibody was raised using the C terminal of LNX1 corresponding to a region with amino acids SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA
- Top Product
- Discover our top product LNX1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LNX1 Blocking Peptide, catalog no. 33R-8514, is also available for use as a blocking control in assays to test for specificity of this LNX1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LNX1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LNX1 (Ligand of Numb-Protein X 1 (LNX1))
- Andere Bezeichnung
- LNX1 (LNX1 Produkte)
- Hintergrund
- LNX1 is a membrane-bound protein that is involved in signal transduction and protein interactions. LNX1 is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis.
- Molekulargewicht
- 70 kDa (MW of target protein)
-