A1BG Antikörper (N-Term)

Produktnummer ABIN630152

Produktdetails anti-A1BG Antikörper

Target: A1BG (alpha-1-B Glycoprotein (A1BG))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser A1BG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: A1 BG antibody was raised against the N terminal of A1 G

Aufreinigung: Purified

Immunogen: A1 BG antibody was raised using the N terminal of A1 G corresponding to a region with amino acids ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

A1BG Blocking Peptide, catalog no. 33R-4184, is also available for use as a blocking control in assays to test for specificity of this A1BG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 G antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu A1BG

Target: A1BG (alpha-1-B Glycoprotein (A1BG))

Andere Bezeichnung: A1BG (A1BG Produkte)

Hintergrund: A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.

Molekulargewicht: 52 kDa (MW of target protein)