A1BG Antikörper (N-Term)
-
- Target Alle A1BG Antikörper anzeigen
- A1BG (alpha-1-B Glycoprotein (A1BG))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser A1BG Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- A1 BG antibody was raised against the N terminal of A1 G
- Aufreinigung
- Purified
- Immunogen
- A1 BG antibody was raised using the N terminal of A1 G corresponding to a region with amino acids ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG
- Top Product
- Discover our top product A1BG Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
A1BG Blocking Peptide, catalog no. 33R-4184, is also available for use as a blocking control in assays to test for specificity of this A1BG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 G antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- A1BG (alpha-1-B Glycoprotein (A1BG))
- Andere Bezeichnung
- A1BG (A1BG Produkte)
- Synonyme
- A1B antikoerper, ABG antikoerper, GAB antikoerper, HYST2477 antikoerper, A1BG antikoerper, C44 antikoerper, alpha-1-B glycoprotein antikoerper, A1BG antikoerper, A1bg antikoerper
- Hintergrund
- A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
- Molekulargewicht
- 52 kDa (MW of target protein)
-