Olfactomedin 4 Antikörper (C-Term)
-
- Target Alle Olfactomedin 4 (OLFM4) Antikörper anzeigen
- Olfactomedin 4 (OLFM4)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Olfactomedin 4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OLFM4 antibody was raised against the C terminal of OLFM4
- Aufreinigung
- Purified
- Immunogen
- OLFM4 antibody was raised using the C terminal of OLFM4 corresponding to a region with amino acids EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN
- Top Product
- Discover our top product OLFM4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OLFM4 Blocking Peptide, catalog no. 33R-2362, is also available for use as a blocking control in assays to test for specificity of this OLFM4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFM4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Olfactomedin 4 (OLFM4)
- Andere Bezeichnung
- OLFM4 (OLFM4 Produkte)
- Synonyme
- tiarin antikoerper, GC1 antikoerper, GW112 antikoerper, OLM4 antikoerper, OlfD antikoerper, UNQ362 antikoerper, bA209J19.1 antikoerper, hGC-1 antikoerper, hOLfD antikoerper, Gm296 antikoerper, Gm913 antikoerper, pPD4 antikoerper, olfactomedin-4 antikoerper, olfactomedin 4 L homeolog antikoerper, olfactomedin 4 antikoerper, olfactomedin-4-like antikoerper, olfm4.L antikoerper, OLFM4 antikoerper, olfm4 antikoerper, LOC100225360 antikoerper, Olfm4 antikoerper
- Hintergrund
- OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined.
- Molekulargewicht
- 55 kDa (MW of target protein)
-