SEMG1 Antikörper (N-Term)

Produktnummer ABIN630160

Produktdetails anti-SEMG1 Antikörper

Target: SEMG1 (Semenogelin I (SEMG1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SEMG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Semenogelin I antibody was raised against the N terminal of SEMG1

Aufreinigung: Purified

Immunogen: Semenogelin I antibody was raised using the N terminal of SEMG1 corresponding to a region with amino acids QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Semenogelin I Blocking Peptide, catalog no. 33R-7601, is also available for use as a blocking control in assays to test for specificity of this Semenogelin I antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SEMG1

Target: SEMG1 (Semenogelin I (SEMG1))

Andere Bezeichnung: Semenogelin I (SEMG1 Produkte)

Synonyme: SEMG1 antikoerper, SEMG1a antikoerper, CT103 antikoerper, SEMG antikoerper, SGI antikoerper, dJ172H20.2 antikoerper, RATSVPIIA antikoerper, SVPIIA antikoerper, SVS2P antikoerper, Svp1 antikoerper, Svs2 antikoerper, Svs2p2 antikoerper, BB115391 antikoerper, Semg1 antikoerper, SvsII antikoerper, semenogelin II antikoerper, semenogelin I antikoerper, semenogelin-2 antikoerper, seminal vesicle secretory protein 2 antikoerper, SEMG2 antikoerper, SEMG1 antikoerper, LOC100408385 antikoerper, Semg1 antikoerper, Svs2 antikoerper

Hintergrund: SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely.

Molekulargewicht: 51 kDa (MW of target protein)