RSAD2 Antikörper (C-Term)
-
- Target Alle RSAD2 Antikörper anzeigen
- RSAD2 (Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RSAD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- RSAD2 antibody was raised against the C terminal of RSAD2
- Aufreinigung
- Purified
- Immunogen
- RSAD2 antibody was raised using the C terminal of RSAD2 corresponding to a region with amino acids YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY
- Top Product
- Discover our top product RSAD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RSAD2 Blocking Peptide, catalog no. 33R-10171, is also available for use as a blocking control in assays to test for specificity of this RSAD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSAD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RSAD2 (Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2))
- Andere Bezeichnung
- RSAD2 (RSAD2 Produkte)
- Hintergrund
- RSAD2 is a potential antiviral effector.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response
-