HMGCL Antikörper
-
- Target Alle HMGCL Antikörper anzeigen
- HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HMGCL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA
- Top Product
- Discover our top product HMGCL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HMGCL Blocking Peptide, catalog no. 33R-10034, is also available for use as a blocking control in assays to test for specificity of this HMGCL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))
- Andere Bezeichnung
- HMGCL (HMGCL Produkte)
- Synonyme
- Afu7g01720 antikoerper, AO090038000541 antikoerper, AW476067 antikoerper, HL antikoerper, zgc:56248 antikoerper, 3-hydroxymethyl-3-methylglutaryl-CoA lyase S homeolog antikoerper, 3-hydroxymethyl-3-methylglutaryl-CoA lyase antikoerper, 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase antikoerper, 3-hydroxy-3-methylglutaryl-Coenzyme A lyase antikoerper, hmgcl.S antikoerper, HMGCL antikoerper, AFUA_7G01720 antikoerper, NFIA_114450 antikoerper, ACLA_065820 antikoerper, AOR_1_910074 antikoerper, PMAA_004600 antikoerper, TSTA_103060 antikoerper, ARB_04874 antikoerper, TRV_06573 antikoerper, Hmgcl antikoerper, hmgcl antikoerper
- Hintergrund
- The deficiency of HMGCL is related to an autosomal recessive branched chain organic aciduria.
- Molekulargewicht
- 36 kDa (MW of target protein)
-