POFUT2 Antikörper (C-Term)

Produktnummer ABIN630165

Produktdetails anti-POFUT2 Antikörper

Target: POFUT2 (Protein O-Fucosyltransferase 2 (POFUT2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POFUT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: POFUT2 antibody was raised against the C terminal of POFUT2

Aufreinigung: Purified

Immunogen: POFUT2 antibody was raised using the C terminal of POFUT2 corresponding to a region with amino acids RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POFUT2 Blocking Peptide, catalog no. 33R-7900, is also available for use as a blocking control in assays to test for specificity of this POFUT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POFUT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POFUT2

Target: POFUT2 (Protein O-Fucosyltransferase 2 (POFUT2))

Andere Bezeichnung: POFUT2 (POFUT2 Produkte)

Synonyme: C21orf80 antikoerper, FUT13 antikoerper, fc46a11 antikoerper, wu:fc46a11 antikoerper, zgc:194822 antikoerper, 2310011G23Rik antikoerper, AI256847 antikoerper, BC003494 antikoerper, protein O-fucosyltransferase 2 antikoerper, POFUT2 antikoerper, pofut2 antikoerper, Pofut2 antikoerper

Hintergrund: POFUT2 catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats.

Molekulargewicht: 49 kDa (MW of target protein)