SEMG1 Antikörper (C-Term)
-
- Target Alle SEMG1 Antikörper anzeigen
- SEMG1 (Semenogelin I (SEMG1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SEMG1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Semenogelin I antibody was raised against the C terminal of SEMG1
- Aufreinigung
- Purified
- Immunogen
- Semenogelin I antibody was raised using the C terminal of SEMG1 corresponding to a region with amino acids GENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQS
- Top Product
- Discover our top product SEMG1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Semenogelin I Blocking Peptide, catalog no. 33R-3239, is also available for use as a blocking control in assays to test for specificity of this Semenogelin I antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMG1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEMG1 (Semenogelin I (SEMG1))
- Andere Bezeichnung
- Semenogelin I (SEMG1 Produkte)
- Hintergrund
- SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely.
- Molekulargewicht
- 51 kDa (MW of target protein)
-