Asporin Antikörper (Middle Region)
-
- Target Alle Asporin (ASPN) Antikörper anzeigen
- Asporin (ASPN)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Asporin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- Asporin antibody was raised against the middle region of ASPN
- Aufreinigung
- Purified
- Immunogen
- Asporin antibody was raised using the middle region of ASPN corresponding to a region with amino acids NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
- Top Product
- Discover our top product ASPN Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Asporin Blocking Peptide, catalog no. 33R-6743, is also available for use as a blocking control in assays to test for specificity of this Asporin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Asporin (ASPN)
- Andere Bezeichnung
- Asporin (ASPN Produkte)
- Synonyme
- OS3 antikoerper, PLAP-1 antikoerper, PLAP1 antikoerper, SLRR1C antikoerper, bgl3 antikoerper, aspnl antikoerper, wu:fk08c11 antikoerper, zgc:109936 antikoerper, 4631401G09Rik antikoerper, AA986886 antikoerper, Plap1 antikoerper, Slrr1c antikoerper, os3 antikoerper, plap-1 antikoerper, plap1 antikoerper, slrr1c antikoerper, asporin antikoerper, asporin (LRR class 1) antikoerper, asporin L homeolog antikoerper, ASPN antikoerper, aspn antikoerper, Aspn antikoerper, aspn.L antikoerper
- Hintergrund
- ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.
- Molekulargewicht
- 42 kDa (MW of target protein)
-