MCM4 Antikörper (Middle Region)

Produktnummer ABIN630173

Produktdetails anti-MCM4 Antikörper

Target: MCM4 (Minichromosome Maintenance Deficient 4 (MCM4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCM4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MCM4 antibody was raised against the middle region of MCM4

Aufreinigung: Purified

Immunogen: MCM4 antibody was raised using the middle region of MCM4 corresponding to a region with amino acids VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MCM4 Blocking Peptide, catalog no. 33R-9921, is also available for use as a blocking control in assays to test for specificity of this MCM4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCM4

Target: MCM4 (Minichromosome Maintenance Deficient 4 (MCM4))

Andere Bezeichnung: MCM4 (MCM4 Produkte)

Synonyme: cdc21 antikoerper, CDC21 antikoerper, CDC54 antikoerper, NKCD antikoerper, NKGCD antikoerper, P1-CDC21 antikoerper, hCdc21 antikoerper, 19G antikoerper, AI325074 antikoerper, AU045576 antikoerper, Cdc21 antikoerper, Mcmd4 antikoerper, mKIAA4003 antikoerper, mcdc21 antikoerper, cb1025 antikoerper, fc12c09 antikoerper, fj85g09 antikoerper, hm:zeh1616 antikoerper, wu:fc12c09 antikoerper, wu:fj85g09 antikoerper, zeh1616 antikoerper, minichromosome maintenance complex component 4 L homeolog antikoerper, minichromosome maintenance complex component 4 S homeolog antikoerper, minichromosome maintenance complex component 4 antikoerper, mcm4.L antikoerper, mcm4.S antikoerper, MCM4 antikoerper, mcm4 antikoerper, Mcm4 antikoerper

Hintergrund: The protein encoded by MCM4 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. The MCM4 gene is mapped to a region on the chromosome 8 head-to-head next to the PRkDaC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks.

Molekulargewicht: 95 kDa (MW of target protein)

Pathways: DNA Reparatur, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA