MCM4 Antikörper (C-Term)
-
- Target Alle MCM4 Antikörper anzeigen
- MCM4 (Minichromosome Maintenance Deficient 4 (MCM4))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MCM4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MCM4 antibody was raised against the C terminal of MCM4
- Aufreinigung
- Purified
- Immunogen
- MCM4 antibody was raised using the C terminal of MCM4 corresponding to a region with amino acids KEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRAL
- Top Product
- Discover our top product MCM4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MCM4 Blocking Peptide, catalog no. 33R-4325, is also available for use as a blocking control in assays to test for specificity of this MCM4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MCM4 (Minichromosome Maintenance Deficient 4 (MCM4))
- Andere Bezeichnung
- MCM4 (MCM4 Produkte)
- Hintergrund
- The protein encoded by MCM4 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRkDaC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported.
- Molekulargewicht
- 95 kDa (MW of target protein)
- Pathways
- DNA Reparatur, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA
-