MCM8 Antikörper (N-Term)
-
- Target Alle MCM8 Antikörper anzeigen
- MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MCM8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MCM8 antibody was raised against the N terminal of MCM8
- Aufreinigung
- Purified
- Immunogen
- MCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH
- Top Product
- Discover our top product MCM8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MCM8 Blocking Peptide, catalog no. 33R-2569, is also available for use as a blocking control in assays to test for specificity of this MCM8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))
- Andere Bezeichnung
- MCM8 (MCM8 Produkte)
- Hintergrund
- MCM8 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.
- Molekulargewicht
- 92 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-