MCM8 Antikörper (N-Term)

Produktnummer ABIN630180

Produktdetails anti-MCM8 Antikörper

Target: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCM8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MCM8 antibody was raised against the N terminal of MCM8

Aufreinigung: Purified

Immunogen: MCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH

Anwendungsinformationen

Applikationshinweise: WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MCM8 Blocking Peptide, catalog no. 33R-2569, is also available for use as a blocking control in assays to test for specificity of this MCM8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCM8

Target: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Andere Bezeichnung: MCM8 (MCM8 Produkte)

Synonyme: C20orf154 antikoerper, dJ967N21.5 antikoerper, 5730432L01Rik antikoerper, minichromosome maintenance 8 homologous recombination repair factor antikoerper, minichromosome maintenance 8 homologous recombination repair factor L homeolog antikoerper, MCM8 antikoerper, Mcm8 antikoerper, mcm8.L antikoerper

Hintergrund: MCM8 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Molekulargewicht: 92 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA