KIF1C Antikörper (C-Term)
-
- Target Alle KIF1C Antikörper anzeigen
- KIF1C (Kinesin Family Member 1C (KIF1C))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KIF1C Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIF1 C antibody was raised against the C terminal of KIF1
- Aufreinigung
- Purified
- Immunogen
- KIF1 C antibody was raised using the C terminal of KIF1 corresponding to a region with amino acids GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP
- Top Product
- Discover our top product KIF1C Primärantikörper
-
anti-Kinesin Family Member 1C (KIF1C) antibody
KIF1C Reaktivität: Human, Ratte, Maus ELISA, WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Kinesin Family Member 1C (KIF1C) (AA 1004-1103) antibodyKIF1C Reaktivität: Human ELISA, WB, IHC (p) Wirt: Maus Monoclonal 1F12 unconjugated
anti-Kinesin Family Member 1C (KIF1C) antibodyKIF1C Reaktivität: Human, Ratte, Maus IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Kinesin Family Member 1C (KIF1C) antibodyKIF1C Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Kinesin Family Member 1C (KIF1C) (AA 810-960) antibodyKIF1C Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Kinesin Family Member 1C (KIF1C) (C-Term) antibodyKIF1C Reaktivität: Human, Ratte, Maus, Hund, Rind (Kuh), Meerschweinchen, Schwein, Kaninchen, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Kinesin Family Member 1C (KIF1C) (AA 1004-1104) antibodyKIF1C Reaktivität: Human ELISA, WB, IHC, IHC (p) Wirt: Maus Monoclonal 1F12 unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIF1C Blocking Peptide, catalog no. 33R-3283, is also available for use as a blocking control in assays to test for specificity of this KIF1C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF1C (Kinesin Family Member 1C (KIF1C))
- Andere Bezeichnung
- KIF1C (KIF1C Produkte)
- Synonyme
- KIF1C antikoerper, ltxs1 antikoerper, DKFZp468E0822 antikoerper, LTXS1 antikoerper, B430105J22Rik antikoerper, D11Bwg1349e antikoerper, Ltxs1 antikoerper, kinesin family member 1C antikoerper, KIF1C antikoerper, kif1c antikoerper, Kif1c antikoerper
- Hintergrund
- KIF1C represents a member of the Unc104 subfamily of kinesin-like proteins that are involved in the transport of mitochondria or synaptic vesicles in axons. KIF1C consists of an amino-terminal motor domain followed by a U104 domain and probably binds to target membranes through carboxyl-terminal sequences.
- Molekulargewicht
- 123 kDa (MW of target protein)
-
