MCM6 Antikörper (C-Term)

Produktnummer ABIN630187

Produktdetails anti-MCM6 Antikörper

Target: MCM6 (Minichromosome Maintenance Complex Component 6 (MCM6))

Bindungsspezifität: C-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCM6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: MCM6 antibody was raised against the C terminal of MCM6

Aufreinigung: Purified

Immunogen: MCM6 antibody was raised using the C terminal of MCM6 corresponding to a region with amino acids RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MCM6 Blocking Peptide, catalog no. 33R-7967, is also available for use as a blocking control in assays to test for specificity of this MCM6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCM6

Target: MCM6 (Minichromosome Maintenance Complex Component 6 (MCM6))

Andere Bezeichnung: MCM6 (MCM6 Produkte)

Synonyme: CG4039 antikoerper, DmMCM6 antikoerper, DmeMCM6 antikoerper, Dmel\\CG4039 antikoerper, MCM6 antikoerper, McM6 antikoerper, fs(1)K1214 antikoerper, mcm6 antikoerper, MCG40308 antikoerper, Mis5 antikoerper, P105MCM antikoerper, Mcmd6 antikoerper, mis5 antikoerper, mmcm6 antikoerper, ASP-l1 antikoerper, D1Wsu22e antikoerper, Minichromosome maintenance 6 antikoerper, DNA replication licensing factor MCM6 antikoerper, minichromosome maintenance complex component 6 antikoerper, minichromosome maintenance complex component 6 L homeolog antikoerper, DNA replication licensing factor mcm-6 antikoerper, Mcm6 antikoerper, TP02_0113 antikoerper, PVX_114735 antikoerper, CMU_027970 antikoerper, MCM6 antikoerper, mcm6.L antikoerper, mcm-6 antikoerper

Hintergrund: The protein encoded by the MCM6 gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.

Molekulargewicht: 90 kDa (MW of target protein)

Pathways: DNA Reparatur, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA