KIF25 Antikörper (C-Term)

Produktnummer ABIN630188

Produktdetails anti-KIF25 Antikörper

Target: KIF25 (Kinesin Family Member 25 (KIF25))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF25 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KIF25 antibody was raised against the C terminal of KIF25

Aufreinigung: Purified

Immunogen: KIF25 antibody was raised using the C terminal of KIF25 corresponding to a region with amino acids VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF25 Blocking Peptide, catalog no. 33R-9657, is also available for use as a blocking control in assays to test for specificity of this KIF25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF25

Target: KIF25 (Kinesin Family Member 25 (KIF25))

Andere Bezeichnung: KIF25 (KIF25 Produkte)

Synonyme: KNSL3 antikoerper, kinesin family member 25 antikoerper, KIF25 antikoerper

Hintergrund: The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation.

Molekulargewicht: 41 kDa (MW of target protein)