KIF22 Antikörper (C-Term)

Produktnummer ABIN630189

Produktdetails anti-KIF22 Antikörper

Target: KIF22 (Kinesin Family Member 22 (KIF22))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF22 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIF22 antibody was raised against the C terminal of KIF22

Aufreinigung: Purified

Immunogen: KIF22 antibody was raised using the C terminal of KIF22 corresponding to a region with amino acids LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF22 Blocking Peptide, catalog no. 33R-4798, is also available for use as a blocking control in assays to test for specificity of this KIF22 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF22 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF22

Target: KIF22 (Kinesin Family Member 22 (KIF22))

Andere Bezeichnung: KIF22 (KIF22 Produkte)

Synonyme: KIF22 antikoerper, T1E22.130 antikoerper, T1E22_130 antikoerper, DKFZp459I1739 antikoerper, A-328A3.2 antikoerper, KID antikoerper, KNSL4 antikoerper, OBP antikoerper, OBP-1 antikoerper, OBP-2 antikoerper, SEMDJL2 antikoerper, AU021460 antikoerper, C81217 antikoerper, Kid antikoerper, Kif22a antikoerper, zgc:171724 antikoerper, kid antikoerper, kid-b antikoerper, kif22-b antikoerper, kiff22-b antikoerper, kiff22b antikoerper, knsl4 antikoerper, obp antikoerper, obp-1 antikoerper, obp-2 antikoerper, kinesin family member 22 antikoerper, ATP binding microtubule motor family protein antikoerper, KIF22 antikoerper, AT5G02370 antikoerper, Kif22 antikoerper, kif22 antikoerper, kif22-a antikoerper

Hintergrund: KIF22 a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.

Molekulargewicht: 73 kDa (MW of target protein)