NOLC1 Antikörper (C-Term)

Produktnummer ABIN630195

Produktdetails anti-NOLC1 Antikörper

Target: NOLC1 (Nucleolar and Coiled-Body Phosphoprotein 1 (NOLC1))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus, Hund, Drosophila melanogaster, Arabidopsis

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOLC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: NOLC1 antibody was raised against the C terminal of NOLC1

Aufreinigung: Purified

Immunogen: NOLC1 antibody was raised using the C terminal of NOLC1 corresponding to a region with amino acids DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOLC1 Blocking Peptide, catalog no. 33R-2089, is also available for use as a blocking control in assays to test for specificity of this NOLC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOLC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOLC1

Target: NOLC1 (Nucleolar and Coiled-Body Phosphoprotein 1 (NOLC1))

Andere Bezeichnung: NOLC1 (NOLC1 Produkte)

Synonyme: NOPP130 antikoerper, NOPP140 antikoerper, NS5ATP13 antikoerper, P130 antikoerper, Nopp140 antikoerper, 3230402K17Rik antikoerper, AA408077 antikoerper, AA536818 antikoerper, AU046071 antikoerper, mKIAA0035 antikoerper, nolc1 antikoerper, fd05f01 antikoerper, fi49h02 antikoerper, nolc1l antikoerper, wu:fd05f01 antikoerper, wu:fi49h02 antikoerper, NOLC1 antikoerper, DKFZp459M126 antikoerper, nopp130 antikoerper, nopp140 antikoerper, ns5atp13 antikoerper, p130 antikoerper, xNopp180 antikoerper, nucleolar and coiled-body phosphoprotein 1 antikoerper, nucleolar and coiled-body phosphoprotein 1 L homeolog antikoerper, NOLC1 antikoerper, Nolc1 antikoerper, nolc1 antikoerper, nolc1.L antikoerper

Hintergrund: Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.

Molekulargewicht: 73 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling