LIG4 Antikörper (N-Term)

Produktnummer ABIN630196

Produktdetails anti-LIG4 Antikörper

Target: LIG4 (Ligase IV, DNA, ATP-Dependent (LIG4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIG4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: LIG4 antibody was raised against the N terminal of LIG4

Aufreinigung: Purified

Immunogen: LIG4 antibody was raised using the N terminal of LIG4 corresponding to a region with amino acids DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIG4 Blocking Peptide, catalog no. 33R-1948, is also available for use as a blocking control in assays to test for specificity of this LIG4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIG4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIG4

Target: LIG4 (Ligase IV, DNA, ATP-Dependent (LIG4))

Andere Bezeichnung: LIG4 (LIG4 Produkte)

Synonyme: zgc:165595 antikoerper, lig4 antikoerper, DNA LIGASE IV antikoerper, LIG4 antikoerper, lig4-A antikoerper, 5830471N16Rik antikoerper, tiny antikoerper, DNL4 antikoerper, ligase IV, DNA, ATP-dependent antikoerper, DNA ligase 4 antikoerper, ATP-dependent DNA ligase implicated in dsDNA break repair via nonhomologous end-joining antikoerper, DNA ligase IV antikoerper, ligase IV, DNA, ATP-dependent L homeolog antikoerper, lig4 antikoerper, LIG4 antikoerper, LOC100212302 antikoerper, CpipJ_CPIJ005161 antikoerper, PTRG_09982 antikoerper, MCYG_05151 antikoerper, LOC657210 antikoerper, ATLIG4 antikoerper, lig4.L antikoerper, Lig4 antikoerper

Hintergrund: LIG4 encodes a DNA ligase that joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. This protein is essential for V(D)J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ). This protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), and further interacts with the DNA-dependent protein kinase (DNA-PK). Both XRCC4 and DNA-PK are known to be required for NHEJ. The crystal structure of the complex formed by this protein and XRCC4 has been resolved. Defects in this gene are the cause of LIG4 syndrome.

Molekulargewicht: 104 kDa (MW of target protein)

Pathways: DNA Reparatur, Production of Molecular Mediator of Immune Response