RBMS1 Antikörper (C-Term)

Produktnummer ABIN630197

Produktdetails anti-RBMS1 Antikörper

Target: RBMS1 (RNA Binding Motif, Single Stranded Interacting Protein 1 (RBMS1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBMS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RBMS1 antibody was raised against the C terminal of RBMS1

Aufreinigung: Purified

Immunogen: RBMS1 antibody was raised using the C terminal of RBMS1 corresponding to a region with amino acids TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBMS1 Blocking Peptide, catalog no. 33R-9396, is also available for use as a blocking control in assays to test for specificity of this RBMS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBMS1

Target: RBMS1 (RNA Binding Motif, Single Stranded Interacting Protein 1 (RBMS1))

Andere Bezeichnung: RBMS1 (RBMS1 Produkte)

Synonyme: C2orf12 antikoerper, HCC-4 antikoerper, MSSP antikoerper, MSSP-1 antikoerper, MSSP-2 antikoerper, MSSP-3 antikoerper, SCR2 antikoerper, YC1 antikoerper, 2600014B10Rik antikoerper, AI255215 antikoerper, RBMS1 antikoerper, fe16a10 antikoerper, wu:fe16a10 antikoerper, RNA binding motif single stranded interacting protein 1 antikoerper, RNA binding motif, single stranded interacting protein 1 antikoerper, RNA binding motif, single stranded interacting protein 1 S homeolog antikoerper, RNA binding motif, single stranded interacting protein 1a antikoerper, RBMS1 antikoerper, Rbms1 antikoerper, rbms1.S antikoerper, rbms1 antikoerper, rbms1a antikoerper

Hintergrund: RBMS1 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.

Molekulargewicht: 44 kDa (MW of target protein)