RNASEH2A Antikörper (Middle Region)
-
- Target Alle RNASEH2A Antikörper anzeigen
- RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNASEH2A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- RNASEH2 A antibody was raised against the middle region of RNASEH2
- Aufreinigung
- Purified
- Immunogen
- RNASEH2 A antibody was raised using the middle region of RNASEH2 corresponding to a region with amino acids AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE
- Top Product
- Discover our top product RNASEH2A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNASEH2A Blocking Peptide, catalog no. 33R-1458, is also available for use as a blocking control in assays to test for specificity of this RNASEH2A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))
- Andere Bezeichnung
- RNASEH2A (RNASEH2A Produkte)
- Hintergrund
- Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.
- Molekulargewicht
- 33 kDa (MW of target protein)
-