KIFC2 Antikörper (N-Term)
-
- Target Alle KIFC2 Antikörper anzeigen
- KIFC2 (Kinesin Family Member C2 (KIFC2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KIFC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- KIFC2 antibody was raised against the N terminal of KIFC2
- Aufreinigung
- Purified
- Immunogen
- KIFC2 antibody was raised using the N terminal of KIFC2 corresponding to a region with amino acids VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE
- Top Product
- Discover our top product KIFC2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIFC2 Blocking Peptide, catalog no. 33R-9783, is also available for use as a blocking control in assays to test for specificity of this KIFC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIFC2 (Kinesin Family Member C2 (KIFC2))
- Andere Bezeichnung
- KIFC2 (KIFC2 Produkte)
- Hintergrund
- Members of the kinesin superfamily of microtubule-associated proteins are involved in a variety of intracellular processes including cell division and organelle transport. KIFC2 encodes a 792 amino acid protein, which contains the conserved motor domain at the C-terminal end of the protein and is most similar to members of the KAR3 family involved in cell division.
- Molekulargewicht
- 90 kDa (MW of target protein)
-