KIFC2 Antikörper (N-Term)

Produktnummer ABIN630204

Produktdetails anti-KIFC2 Antikörper

Target: KIFC2 (Kinesin Family Member C2 (KIFC2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIFC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KIFC2 antibody was raised against the N terminal of KIFC2

Aufreinigung: Purified

Immunogen: KIFC2 antibody was raised using the N terminal of KIFC2 corresponding to a region with amino acids VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIFC2 Blocking Peptide, catalog no. 33R-9783, is also available for use as a blocking control in assays to test for specificity of this KIFC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIFC2

Target: KIFC2 (Kinesin Family Member C2 (KIFC2))

Andere Bezeichnung: KIFC2 (KIFC2 Produkte)

Synonyme: kinesin family member C2 antikoerper, Kifc2 antikoerper, KIFC2 antikoerper

Hintergrund: Members of the kinesin superfamily of microtubule-associated proteins are involved in a variety of intracellular processes including cell division and organelle transport. KIFC2 encodes a 792 amino acid protein, which contains the conserved motor domain at the C-terminal end of the protein and is most similar to members of the KAR3 family involved in cell division.

Molekulargewicht: 90 kDa (MW of target protein)