PIK3CB Antikörper (C-Term)

Produktnummer ABIN630206

Produktdetails anti-PIK3CB Antikörper

Target: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIK3CB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIK3 CB antibody was raised against the C terminal of PIK3 B

Aufreinigung: Purified

Immunogen: PIK3 CB antibody was raised using the C terminal of PIK3 B corresponding to a region with amino acids VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIK3CB Blocking Peptide, catalog no. 33R-9615, is also available for use as a blocking control in assays to test for specificity of this PIK3CB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 B antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIK3CB

Target: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Andere Bezeichnung: PIK3CB (PIK3CB Produkte)

Synonyme: P110BETA antikoerper, PI3K antikoerper, PI3KBETA antikoerper, PIK3C1 antikoerper, fb92a07 antikoerper, wu:fb92a07 antikoerper, 1110001J02Rik antikoerper, AI447572 antikoerper, p110beta antikoerper, PI3Kbeta antikoerper, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta antikoerper, phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta antikoerper, PIK3CB antikoerper, pik3cb antikoerper, Pik3cb antikoerper

Hintergrund: Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110 kDa catalytic subunit, such as PIK3CB, and an 85 kDa adaptor subunit.

Molekulargewicht: 123 kDa (MW of target protein)