FICD Antikörper (C-Term)

Produktnummer ABIN630209

Produktdetails anti-FICD Antikörper

Target: FICD (FIC Domain Containing (FICD))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FICD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FICD antibody was raised against the C terminal Of Ficd

Aufreinigung: Purified

Immunogen: FICD antibody was raised using the C terminal Of Ficd corresponding to a region with amino acids FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FICD Blocking Peptide, catalog no. 33R-2836, is also available for use as a blocking control in assays to test for specificity of this FICD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FICD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FICD

Target: FICD (FIC Domain Containing (FICD))

Andere Bezeichnung: FICD (FICD Produkte)

Synonyme: HIP13 antikoerper, HYPE antikoerper, UNQ3041 antikoerper, D5Ertd40e antikoerper, Hype antikoerper, FIC domain containing antikoerper, FICD antikoerper, Ficd antikoerper

Hintergrund: FICD is an adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. It is able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified.

Molekulargewicht: 52 kDa (MW of target protein)