GNB1L Antikörper

Produktnummer ABIN630215

Produktdetails anti-GNB1L Antikörper

Target: GNB1L (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNB1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: GNB1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNB1L Blocking Peptide, catalog no. 33R-8245, is also available for use as a blocking control in assays to test for specificity of this GNB1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNB1L

Target: GNB1L (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L))

Andere Bezeichnung: GNB1L (GNB1L Produkte)

Synonyme: DGCRK3 antikoerper, GY2 antikoerper, WDR14 antikoerper, WDVCF antikoerper, ESTM55 antikoerper, Gm16314 antikoerper, Me49f07 antikoerper, OTTMUSG00000033458 antikoerper, Wdr14 antikoerper, Wdvcf antikoerper, GNB1L antikoerper, zgc:110763 antikoerper, G protein subunit beta 1 like antikoerper, guanine nucleotide binding protein (G protein), beta polypeptide 1-like antikoerper, GNB1L antikoerper, Gnb1l antikoerper, gnb1l antikoerper

Hintergrund: GNB1L is a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. Therefore, this gene may contribute to the etiology of those disorders.

Molekulargewicht: 36 kDa (MW of target protein)