BLK Antikörper (Middle Region)
-
- Target Alle BLK Antikörper anzeigen
- BLK (B Lymphoid Tyrosine Kinase (BLK))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BLK Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BLK antibody was raised against the middle region of BLK
- Aufreinigung
- Purified
- Immunogen
- BLK antibody was raised using the middle region of BLK corresponding to a region with amino acids AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY
- Top Product
- Discover our top product BLK Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BLK Blocking Peptide, catalog no. 33R-1621, is also available for use as a blocking control in assays to test for specificity of this BLK antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLK antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BLK (B Lymphoid Tyrosine Kinase (BLK))
- Andere Bezeichnung
- BLK (BLK Produkte)
- Synonyme
- bltk antikoerper, si:dkey-33i22.2 antikoerper, zgc:136231 antikoerper, MODY11 antikoerper, BLK proto-oncogene, Src family tyrosine kinase antikoerper, B lymphoid kinase antikoerper, blk antikoerper, BLK antikoerper, Blk antikoerper
- Hintergrund
- BLK may function in a signal transduction pathway that is restricted to B-lymphoid cells.
- Molekulargewicht
- 58 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling
-