NSMCE1 Antikörper

Produktnummer ABIN630218

Produktdetails anti-NSMCE1 Antikörper

Target: NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NSMCE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NSMCE1 Blocking Peptide, catalog no. 33R-8094, is also available for use as a blocking control in assays to test for specificity of this NSMCE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSMCE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NSMCE1

Target: NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))

Andere Bezeichnung: NSMCE1 (NSMCE1 Produkte)

Synonyme: zgc:92777 antikoerper, NSMCE1 antikoerper, NSE1 antikoerper, 2510027N19Rik antikoerper, RGD1307760 antikoerper, NSE1 homolog, SMC5-SMC6 complex component antikoerper, NSE1 homolog, SMC5-SMC6 complex component L homeolog antikoerper, nsmce1 antikoerper, NSMCE1 antikoerper, nsmce1.L antikoerper, Nsmce1 antikoerper

Hintergrund: NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus