GEM Antikörper (C-Term)
-
- Target Alle GEM Antikörper anzeigen
- GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GEM Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- GEM antibody was raised against the C terminal of GEM
- Aufreinigung
- Purified
- Immunogen
- GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL
- Top Product
- Discover our top product GEM Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GEM Blocking Peptide, catalog no. 33R-3073, is also available for use as a blocking control in assays to test for specificity of this GEM antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GEM antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))
- Andere Bezeichnung
- GEM (GEM Produkte)
- Hintergrund
- GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.
- Molekulargewicht
- 33 kDa (MW of target protein)
-