GEM Antikörper (C-Term)
-
- Target Alle GEM Antikörper anzeigen
- GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GEM Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- GEM antibody was raised against the C terminal of GEM
- Aufreinigung
- Purified
- Immunogen
- GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL
- Top Product
- Discover our top product GEM Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GEM Blocking Peptide, catalog no. 33R-3073, is also available for use as a blocking control in assays to test for specificity of this GEM antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GEM antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))
- Andere Bezeichnung
- GEM (GEM Produkte)
- Synonyme
- KIR antikoerper, GEM antikoerper, DKFZp470D0612 antikoerper, LOC100221129 antikoerper, kir antikoerper, xgem antikoerper, zgc:153003 antikoerper, Gem antikoerper, AV020497 antikoerper, GTP binding protein overexpressed in skeletal muscle antikoerper, geminin, DNA replication inhibitor antikoerper, GTP binding protein (gene overexpressed in skeletal muscle) antikoerper, GEM antikoerper, gem antikoerper, Gem antikoerper, GMNN antikoerper
- Hintergrund
- GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.
- Molekulargewicht
- 33 kDa (MW of target protein)
-