RGS Antikörper (N-Term)

Produktnummer ABIN630222

Produktdetails anti-RGS Antikörper

Target: RGS (Regulator of G-Protein Signaling 9 (RGS))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RGS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RGS9 antibody was raised against the N terminal of RGS9

Aufreinigung: Purified

Immunogen: RGS9 antibody was raised using the N terminal of RGS9 corresponding to a region with amino acids MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ

Anwendungsinformationen

Applikationshinweise: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RGS9 Blocking Peptide, catalog no. 33R-6633, is also available for use as a blocking control in assays to test for specificity of this RGS9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RGS

Target: RGS (Regulator of G-Protein Signaling 9 (RGS))

Andere Bezeichnung: RGS9 (RGS Produkte)

Synonyme: LOC100218209 antikoerper, RGS9-1 antikoerper, Rgs9-2 antikoerper, PERRS antikoerper, RGS9L antikoerper, regulator of G-protein signaling 9 antikoerper, regulator of G protein signaling 9 antikoerper, RGS9 antikoerper, Tsp_08067 antikoerper, Rgs9 antikoerper

Hintergrund: RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Phototransduction