APOBEC3G Antikörper (N-Term)
-
- Target Alle APOBEC3G Antikörper anzeigen
- APOBEC3G (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G (APOBEC3G))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APOBEC3G Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ApoBEC3 G antibody was raised against the N terminal of APOBEC3
- Aufreinigung
- Purified
- Immunogen
- ApoBEC3 G antibody was raised using the N terminal of APOBEC3 corresponding to a region with amino acids AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
- Top Product
- Discover our top product APOBEC3G Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ApoBEC3G Blocking Peptide, catalog no. 33R-1295, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3G antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOBEC3G (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3G (APOBEC3G))
- Andere Bezeichnung
- ApoBEC3G (APOBEC3G Produkte)
- Synonyme
- A3G antikoerper, ARCD antikoerper, ARP-9 antikoerper, ARP9 antikoerper, CEM-15 antikoerper, CEM15 antikoerper, bK150C2.7 antikoerper, dJ494G10.1 antikoerper, apolipoprotein B mRNA editing enzyme catalytic subunit 3G antikoerper, APOBEC3G antikoerper
- Hintergrund
- Anti-APOBEC3G is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.
- Molekulargewicht
- 46 kDa (MW of target protein)
-