APCS Antikörper (N-Term)

Produktnummer ABIN630228

Produktdetails anti-APCS Antikörper

Target: APCS (Amyloid P Component, Serum (APCS))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APCS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: APCS antibody was raised against the N terminal of APCS

Aufreinigung: Purified

Immunogen: APCS antibody was raised using the N terminal of APCS corresponding to a region with amino acids NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

APCS Blocking Peptide, catalog no. 33R-6691, is also available for use as a blocking control in assays to test for specificity of this APCS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APCS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APCS

Target: APCS (Amyloid P Component, Serum (APCS))

Andere Bezeichnung: APCS (APCS Produkte)

Synonyme: PTX2 antikoerper, SAP antikoerper, Sap antikoerper, APCS antikoerper, FP antikoerper, SAP(FP) antikoerper, apcs antikoerper, ptx2 antikoerper, sap antikoerper, amyloid P component, serum antikoerper, serum amyloid P-component antikoerper, amyloid P component, serum protein L homeolog antikoerper, APCS antikoerper, Apcs antikoerper, apcs.L antikoerper

Hintergrund: APCS is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo.

Molekulargewicht: 25 kDa (MW of target protein)