Complement C2 Antikörper (Middle Region)

Produktnummer ABIN630230

Produktdetails anti-Complement C2 Antikörper

Target: Complement C2

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Complement C2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Complement C2 antibody was raised against the middle region of C2

Aufreinigung: Purified

Immunogen: Complement C2 antibody was raised using the middle region of C2 corresponding to a region with amino acids INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Complement C2 Blocking Peptide, catalog no. 33R-4079, is also available for use as a blocking control in assays to test for specificity of this Complement C2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Complement C2

Target: Complement C2

Abstract: Complement C2 Produkte

Synonyme: CO2 antikoerper, complement C2 antikoerper, complement component 2 (within H-2S) antikoerper, C2 antikoerper

Hintergrund: Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.

Molekulargewicht: 83 kDa (MW of target protein)