STK3 Antikörper
-
- Target Alle STK3 Antikörper anzeigen
- STK3 (serine/threonine Kinase 3 (STK3))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STK3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- STK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ
- Top Product
- Discover our top product STK3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STK3 Blocking Peptide, catalog no. 33R-3940, is also available for use as a blocking control in assays to test for specificity of this STK3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STK3 (serine/threonine Kinase 3 (STK3))
- Andere Bezeichnung
- STK3 (STK3 Produkte)
- Synonyme
- KRS1 antikoerper, MST2 antikoerper, 0610042I06Rik antikoerper, MST antikoerper, Mst2 antikoerper, Mst3 antikoerper, Ste20 antikoerper, mess1 antikoerper, mst2 antikoerper, xstk3 antikoerper, wu:fc19e11 antikoerper, zgc:55383 antikoerper, serine/threonine kinase 3 antikoerper, serine/threonine kinase 3 S homeolog antikoerper, serine/threonine kinase 3 (STE20 homolog, yeast) antikoerper, STK3 antikoerper, Stk3 antikoerper, stk3.S antikoerper, stk3 antikoerper
- Hintergrund
- Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Tube Formation
-